PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G285100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 394aa    MW: 44864.2 Da    PI: 5.4868
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G285100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-18160206148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg WTteEd +lv +vk++G ++W+ Ia++m+ gR +kqc++rw+++l
  Aqcoe3G285100.1.p 160 RGQWTTEEDRKLVGLVKKYGDKHWTYIAHKMN-GRIGKQCRERWHNHL 206
                        89******************************.*************97 PP

2Myb_DNA-binding58.81.2e-18212254145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        +  WT++Ed  l++a+k+lG++ W+ Ia++++ gRt++++k++w+
  Aqcoe3G285100.1.p 212 KETWTEDEDNALIKAHKELGNK-WAEIAKRLP-GRTENSIKNHWN 254
                        578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.979155206IPR017930Myb domain
SuperFamilySSF466898.3E-31157253IPR009057Homeodomain-like
SMARTSM007171.6E-14159208IPR001005SANT/Myb domain
PfamPF002498.7E-16160206IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-25161212IPR009057Homeodomain-like
CDDcd001673.26E-14163206No hitNo description
PROSITE profilePS5129427.324207261IPR017930Myb domain
SMARTSM007175.7E-18211259IPR001005SANT/Myb domain
PfamPF002494.1E-17212254IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-22213259IPR009057Homeodomain-like
CDDcd001678.70E-15214257No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MVLSGASSPG DQESSSKGSM EDNLNVDQFS FNGMITSNSN FELPLPYLDP LDTLACGNSI  60
NNLDMIDSRS FMLEEGGNGL GEFPNIDFLD CPDHEMSFSD SISHNQNMIM NFQGNVSPML  120
ANFGLSDEVS CITADNRFDT IAWNESNMQM SFDRKMNAAR GQWTTEEDRK LVGLVKKYGD  180
KHWTYIAHKM NGRIGKQCRE RWHNHLRPNI KKETWTEDED NALIKAHKEL GNKWAEIAKR  240
LPGRTENSIK NHWNATKRKQ FARRRRRRSA KYAGASNILQ NYIKSLGPDV ARGPYRRRIF  300
SCNRNFLTTN VTKMSVDANA KRVSNDNDLL IPDLPYDFDM SLFDDDLPCG DLGLENEDLD  360
YDTAMPSDWT SPAPEFHVKK ELDLLEMISQ KNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-451602597107B-MYB
1msf_C3e-451602604104C-Myb DNA-Binding Domain
1mse_C3e-451602604104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256267KRKQFARRRRRR
2262267RRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A067FTX05e-76A0A067FTX0_CITSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-61myb domain protein 98